}, "context" : "envParam:feedbackData", "actions" : [ "context" : "lia-deleted-state", } "event" : "MessagesWidgetEditCommentForm", "useSubjectIcons" : "true", "event" : "RevokeSolutionAction", "action" : "rerender" ] ] "context" : "envParam:quiltName", } ] "initiatorDataMatcher" : "data-lia-message-uid" } { "action" : "rerender" Are you sure you want to proceed? } { "actions" : [ "context" : "envParam:quiltName", }); ] }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "revokeMode" : "true", }, "messageViewOptions" : "1111110111111111111110111110100101001101" { }, }, East coast USA here. } "disallowZeroCount" : "false", "componentId" : "kudos.widget.button", } { "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] "event" : "MessagesWidgetCommentForm", ] "initiatorBinding" : true, } LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_11","componentSelector":"#lineardisplaymessageviewwrapper_11","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":77189,"confimationText":"You have other message editors open and your data inside of them might be lost. "parameters" : { } "componentId" : "kudos.widget.button", }, "eventActions" : [ LITHIUM.AjaxSupport.ComponentEvents.set({ "componentId" : "forums.widget.message-view", }, "componentId" : "kudos.widget.button", "includeRepliesModerationState" : "false", { }, "initiatorBinding" : true, "initiatorBinding" : true, "actions" : [ ] { "context" : "envParam:selectedMessage", ] "actions" : [ "event" : "MessagesWidgetEditAction", ] "action" : "pulsate" "action" : "rerender" ] }, } LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "deleteMessage", "action" : "rerender" "actions" : [ ] Diffuser, Meraki, Duftpinde til salg, da vi ikke brød os om duften alligevel! }, "}); "event" : "addThreadUserEmailSubscription", { "action" : "rerender" "actions" : [ "action" : "rerender" } "context" : "", "action" : "rerender" "initiatorDataMatcher" : "data-lia-message-uid" { "action" : "rerender" "action" : "rerender" "disableKudosForAnonUser" : "false", "event" : "ProductMessageEdit", Are you sure you want to proceed? "entity" : "76890", 8543 Hornslet 18. okt 75 kr. "actions" : [ "actions" : [ "event" : "removeThreadUserEmailSubscription", }, LITHIUM.AjaxSupport.ComponentEvents.set({ "messageViewOptions" : "1111110111111111111110111110100101001101" }, "action" : "pulsate" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_6","componentSelector":"#lineardisplaymessageviewwrapper_6","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":76960,"confimationText":"You have other message editors open and your data inside of them might be lost. { Are you sure you want to proceed? "context" : "", "event" : "MessagesWidgetEditAction", "context" : "", { "event" : "ProductMessageEdit", "initiatorBinding" : true, "actions" : [ { "action" : "rerender" "event" : "RevokeSolutionAction", "initiatorBinding" : true, } }, }, } }, "parameters" : { "context" : "", "message" : "77129", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_10","feedbackSelector":".InfoMessage"}); { "context" : "envParam:quiltName,message", { { Sounds like DNS resolution is not possible for your client. Brug duftfriskeren til at sprede en dejlig duft i hjemmet, på badeværelset, i soveværelset eller i stuen. } "parameters" : { { "actions" : [ Our dashboards have been showing the below for four hours now: Perhaps the IPv6 rollout is having a wobble...? "action" : "rerender" } { "}); ] { "context" : "envParam:entity", Her finder du body lotion, body milk, body gel og body cream til alle hudtyper og behov. LITHIUM.AjaxSupport.fromLink('#kudoEntity_21', 'kudoEntity', '#ajaxfeedback_21', 'LITHIUM:ajaxError', {}, 'rAfY5alR5JQR1kCWG9YOxDJSCGoMWfmcrYtjs7R_Olw. "action" : "rerender" "revokeMode" : "true", ] "event" : "QuickReply", ] "event" : "editProductMessage", "disableLinks" : "false", "actions" : [ "disallowZeroCount" : "false", ] "actions" : [ }, LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_26","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "MessagesWidgetAnswerForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_10","menuItemsSelector":".lia-menu-dropdown-items"}}); { } "action" : "pulsate" }, "action" : "rerender" { { "event" : "approveMessage", { "context" : "", "context" : "", "context" : "", "event" : "ProductAnswer", ] "action" : "rerender" "context" : "", { ] "actions" : [ }, 165 kr. "actions" : [ { { { "action" : "addClassName" Nordic Nest AB (org. "event" : "ProductAnswerComment", "event" : "removeThreadUserEmailSubscription", "context" : "", ] { "event" : "approveMessage", { } }, { LITHIUM.MessageBodyDisplay('#bodyDisplay_11', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_28","feedbackSelector":".InfoMessage"}); "actions" : [ }, "action" : "rerender" "event" : "deleteMessage", "componentId" : "kudos.widget.button", } { "actions" : [ { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_16","menuItemsSelector":".lia-menu-dropdown-items"}}); "disableKudosForAnonUser" : "false", Meraki Scented Sachet Lavender 2 … "disallowZeroCount" : "false", } }, }, "actions" : [ "selector" : "#messageview_2", "message" : "76892", "actions" : [ "disallowZeroCount" : "false", "useSubjectIcons" : "true", "actions" : [ { "messageViewOptions" : "1111110111111111111110111110100101001101" { Dine hænder efterlades rene samt velduftende. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "envParam:quiltName,expandedQuiltName", { "useTruncatedSubject" : "true", { "actions" : [ "actions" : [ "parameters" : { "actions" : [ } "action" : "rerender" } { "actions" : [ { ], "actions" : [ { { } "action" : "rerender" Skab en skøn atmosfære i hjemmet med Merakis velduftende duftfrisker. "kudosable" : "true", { "context" : "", "actions" : [ "initiatorBinding" : true, "quiltName" : "ForumMessage", "action" : "pulsate" "event" : "unapproveMessage", "quiltName" : "ForumMessage", "context" : "envParam:feedbackData", }, "action" : "rerender" }, ] "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } "context" : "lia-deleted-state", "action" : "rerender" ], { "event" : "MessagesWidgetEditAnswerForm", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_15","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_20","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_20","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/dashboard/thread-id/2832","ajaxErrorEventName":"LITHIUM:ajaxError","token":"30VFTJsGqNKzSdA19ahSztMnI0eyIGHDUavBl9xqMNk. } { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, { "context" : "envParam:entity", }, "action" : "rerender" { "event" : "addThreadUserEmailSubscription", "actions" : [ { "eventActions" : [ { "eventActions" : [ ] { "action" : "rerender" } } "event" : "MessagesWidgetEditCommentForm", "event" : "approveMessage", }, "event" : "kudoEntity", }, } { "displaySubject" : "true", }, { { { "event" : "AcceptSolutionAction", "action" : "rerender" }, ] "actions" : [ } }, } "event" : "expandMessage", "event" : "addMessageUserEmailSubscription", { "event" : "ProductMessageEdit", ], ], "event" : "markAsSpamWithoutRedirect", }, { "action" : "pulsate" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_21","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_21","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/dashboard/thread-id/2832","ajaxErrorEventName":"LITHIUM:ajaxError","token":"XGBNfdZiZ5E_mlk9hEFzrWoCWOvv69s2rF48CQ2fNPQ. { APs and MX showing offline. { { "disableLabelLinks" : "false", "context" : "envParam:selectedMessage", "actions" : [ "actions" : [ } { "actions" : [ } "actions" : [ { { "context" : "envParam:quiltName", } }, }); "actions" : [ }, ] "useSubjectIcons" : "true", ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_15","feedbackSelector":".InfoMessage"}); But that is almost certainly a failover between datacentres. ] { ] "actions" : [ }, }, } ] }, { "context" : "envParam:quiltName,message,product,contextId,contextUrl", { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } Dejligt forfriskende duftpinde fra Meraki til dit hjem. { { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_19","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_19","url":"https://community.meraki.com/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/dashboard/thread-id/2832","ajaxErrorEventName":"LITHIUM:ajaxError","token":"3OoINgqbk9CaHKPg7zIuhE5pPscOx7JNLeQ_WMM3-BA. "actions" : [ "parameters" : { { Meraki Duftfrisker m. 7 Pinde Nordic Pine Str 120ml/4.0 fl.oz - Øvrigt Badtilbehør hos Magasin - No_Color, Meraki Duftfrisker, m. 7 pinde, Nordic pine, 120 ml/4.0 fl.oz, Room-diffuser, Meraki Scan garden 120 ml Nordic pine. Ja tak, jeg vil gerne modtage nyheder og tilbud inden for PriceRunners produktsortiment samt konkurrencer og tips via e-mail. "context" : "envParam:quiltName", { }, { }); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_79","feedbackSelector":".InfoMessage"}); "actions" : [ { }, Duftfriskeren består af 7 duftpinde, der spreder en skøn duft rundt i hjemmet. } ] { { "showCountOnly" : "false", "action" : "rerender" "actions" : [ "action" : "pulsate" ], "initiatorDataMatcher" : "data-lia-message-uid" "action" : "rerender" }, "kudosLinksDisabled" : "false", "displaySubject" : "true", "action" : "rerender" { { { "event" : "removeMessageUserEmailSubscription", "context" : "envParam:quiltName,message", "displaySubject" : "true", { "action" : "pulsate" "action" : "rerender" }, { "action" : "rerender" "displaySubject" : "true", { "context" : "envParam:feedbackData", "action" : "rerender" { { { { "context" : "", "context" : "", "action" : "rerender" }, } } I suspect that they just forgot to use a FQDN on a temporary CNAME record, and the short name they used, sdg327, wasn't resolvable by anyone except if you were using one of their domain joined computers. }, { "context" : "envParam:quiltName,message", { "disableLinks" : "false", "context" : "", "context" : "lia-deleted-state", "context" : "lia-deleted-state", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ] $(this).on('click', function() { "selector" : "#messageview_7", { }, }, "actions" : [ "truncateBodyRetainsHtml" : "false", { } }, LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "MessagesWidgetEditCommentForm", }, { "event" : "ProductMessageEdit", { When it started working for me it was changed to this: Answers: account.meraki.com. "componentId" : "kudos.widget.button", "forceSearchRequestParameterForBlurbBuilder" : "false", }, "context" : "envParam:quiltName,product,contextId,contextUrl",
Frokost Horsens Take Away, 1 Værelses Lejlighed Risskov Brynet, Indledning Det Blomstrende Slagsmål, Energi Fyns Almene Fond, Dyrepasserelev Søges 2021, Udskænkning Af Alkohol Lukket Fest, Bunkermuseum Rold Skov, Sole Diesel Mini 11 Manual,